Incriminating evidence

Please ask your doctor to explain to us how we got it wrong. We’d love to be shown we are wrong. But none of the health authorities want to talk to us for some reason. Not even for $1M.

by Steve Kirsch, January 17th 2022

Here is a collection of evidence that highlights the glaring errors in our pandemic response.

It is very important to educate doctors because most people rely on their doctors for advice. You can help by bringing this document to your doctor’s attention. Ask her if she will help to correct this “misinformation” by meeting with us in a recorded video. We will be happy to compensate her generously for her time. So far, nobody wants to talk to us on the record.

Since nobody inside the CDC, NIH, or FDA will talk to me or any members of my team of experts, I have tried to discuss the evidence summarized in this document with the members of the outside committee members of the CDC and FDA. I offered them $1M to take a meeting (or I will donate it to a charity of their choice if they want). They all refused. I have no idea why. They won’t tell me. I didn’t even get a counter offer. It’s so hard to give away a million dollars nowadays.

I’m extending my $1M offer to members of the VRBPAC and ACIP committees until the end of January 2022

In the hope of resolving these issues, I’m extending my offer until the end of January 2022. $1M to have a recorded discussion with the committee members on each item in this article. Why not clear the air so that the American people can decide for themselves who is telling the truth?

Those who refuse to consider this evidence put the entire future of medicine and health care in jeopardy, including their own careers.

Why would a committee member refuse $1M just to have a discussion on the science? As far as I know, you’d only refuse if you had something big that you wanted to hide, e.g., that you are incompetent to make decisions about the safety of these vaccines.

Moving someone from blue pill to red pill

When I first started on this journey, I thought if I put together a compelling story all backed by solid data and analysis and published in a peer-reviewed journal, we’d be done. Not so.

Consider the following real-life example: 4 neurologists in the same practice. One realizes that out of 20,000 patients they have 2,000 vaccine injured. She cannot convince her partners of this no matter how hard she tries. They all think it is bad luck. Even after the other docs get the vaccine and one of them is severely vaccine injured, he still wants to get the booster to protect himself from COVID.

My red pill doctor is amazed that her partners are so brainwashed that they cannot see what is going on; it is obvious to her.

So that’s how how bad it is and how difficult it is to change minds.

The most convincing evidence: seeing family or friends disabled or dead after vaccination

For many people, the most convincing argument is not the scientific data presented here, but seeing what happened to a formerly perfectly healthy friend or family member (or famous public figure) after they took the vaccine.

In my case, I lost confidence in the COVID vaccines when a friend told me that three of her relatives died shortly after being vaccinated (and they were all perfectly healthy before the shot). A week later, another friend had a heart attack 2 minutes after getting the vaccine and his wife developed Parkinson’s symptoms after she got her vaccine.

Today, my wife just told me that one of her friends recently got boosted and now her four kids don’t have a mother anymore. It’s tragic, but for most people, it takes many events like this before people wake up and realize they’ve been lied to.

Here’s a comment from one of my readers:

Just today I heard of another person I know who has had a sudden return of a cancer which was in remission for several years, 2 weeks after taking the vaccine. Brain tumor. Family devastated. One thing I am finding more and more personally traumatic, is the dilemma of how hard to try to convince people not to take it. I am the ‘laissez-faire’ type. I give information as much as I can, but I don’t push once someone puts up the proverbial hands and shows a clear message that they don’t want to hear it. This is the second time I have been faced with contacts or friends who I WISH I had tried harder to convince. But if they won’t listen, what can we do? It’s a HORRIBLE situation this. Bearing in my mind just today I heard my own parents are lining up for their boosters. What a shit show this world is today.

In most cases, the victims remain silent because they don’t want to be ostracized or receive death threats. So you rarely hear of the incidents. Also, the press will never cover the reactions because the media cannot prove the vaccine was the cause of the event.

People will eventually start to make the link between vaccination and the sudden, unexpected onset of neurological, cardiovascular, or immunological symptoms such as:

  1. death (including death in your sleep)
  2. COVID infection
  3. cardiac arrest
  4. pulmonary embolism
  5. intracranial hemorrhage
  6. Bell’s Palsy
  7. Guillain-Barre
  8. peripheral neuropathy
  9. severe and persistent muscle spasms
  10. menstrual issues (high flow, low flow, start, stop, timing)
  11. Re-emergence of latent disease (cancers, shingles, etc.)
  12. Worsening diabetes
  13. and hundreds more serious adverse events that are obvious in VAERS but where the CDC is staying silent

Tragically, when all these events happen, the news reports never mention that the person was recently vaccinated. Many never realize it was due to the vaccine because the vaccine is supposed to be completely safe.

For example, Celine Dion’s career ended shortly after she got vaccinated. Did anyone ever notice that the singer never announced the cause of her sudden uncontrolled muscle spasms? Did her agent ever tell the public why the vaccine was ruled out as a possible cause? Nope.

Uncontrolled muscle spasms post-vaccination is a very common side effect of the vaccine, especially in women. Is it possible that her injury was just bad luck? Of course, but statistically, it is far more likely that her injury was caused by the COVID vaccines. If she isn’t being treated by a specialist in vaccine injury, she may never return to the stage.

As these “unexpected” events happen more and more to your friends and famous people right after taking the vaccine, it will start to wake people up.

For example, President Biden developed peripheral neuropathy after his booster. His physicians ruled out every other possible cause.

Governor Newsom developed Guillain-Barré within days after his booster. What’s troubling is that even after seeing first hand how dangerous the vaccine is, he still wants to mandate that all kids in California get the same vaccine that injured him (but he will not vaccinate his own kids).

UK removes COVID restrictions

UK Prime Minister Boris Johnson on Wednesday said that most restrictions deployed to fight the latest wave of the COVID-19 pandemic in England would be lifted from next week.

People will no longer have to wear masks in closed spaces, work from home and prove vaccination to enter public spaces such as nightclubs, Johnson told parliament.

For more info, see Boris Johnson ends COVID restrictions.

Nobel prize winner and top virologist Luc Montagnier calls for an immediate halt to the COVID vaccines

“I ask all my colleagues to absolutely stop vaccinating with this type of vaccine. Doctors today are perfectly informed of what I am saying, and therefore they should intervene immediately because the future of humanity is at stake.”

Here are his full remarks.

Even the top WHO expert now agrees no boosters for kids

According to the WHO: “There are currently no efficacy or safety data for children below the age of 12 years. Until such data are available, individuals below 12 years of age should not be routinely vaccinated”

Twitter avatar for @IanLyne3Ian Lyne @IanLyne3

Top WHO scientist Dr. @doctorsoumya says there’s no evidence healthy children and adolescents need #COVID19 boosters. #TogetherDeclaration

Our pandemic response is making the problem worse and worse

This Expose article points out that Countries with high Covid-19 Vaccination Rates all suffered an extraordinary rise in Excess Deaths in 2021 suggesting the Jabs are to blame.

Here are two charts, one showing cases in the US, the other showing infection rate of the vaccinated vs. unvaccinated by age. Both are clear indicators that our interventions are making things worse, not better. Instead of doubling-down on our interventions, why not start listening to the people who were trying to warn the world about how dangerous these vaccines are?

The data from the UK and Scotland shows vaccinated people are more likely to be infected than unvaccinated people. The mandates are making things worse, not better.

This is happening in the US as well. By vaccinating people, we are making them more likely to be infected which is why case rates are through the roof:

Israel is doing a terrible job. Why are we following what they do and expecting a different result??

Twitter avatar for @DrEliDavidDr. Eli David @DrEliDavid

Israel 🇮🇱, the only quadruple-vaxxed country in the world (also using mask mandates and Covid passports), just broke global record for daily Covid cases 💪

Image

Viral spread

A top Israeli scientist admits the vaccines do not stop transmission. So all the nonsense about a “society benefit” to vaccination is nonsense. The data shows there is a short-term personal benefit but it quickly goes negative.

AFAIK, there is no solid evidence of:

  1. Social distancing 6 to 60 feet making any difference (as shown in the MIT study in April 2021 that the CDC ignored)
  2. Asymptomatic spread (see next section)
  3. Spread outdoors
  4. A naturally recovered person getting re-infected and then infecting another person

We should be treating anyone who is recovered from COVID better than any vaccinated person. We aren’t. In general, we are insulting them (like Aaron Rogers).

Nurses I’ve talked to say you can basically treat based on symptoms; tests aren’t needed at all.

Lack of proof of asymptomatic spread

This is a study that looked at several hundred asymptomatic people (tested positive for covid, but had no symptoms). They looked at 1,174 close contacts of these asymptomatic individuals and could not find ONE CASE of a person getting COVID from the asymptomatic people. It’s difficult to prove a negative, but if you can’t find one case out of nearly 1200 people who were in close contact to asymptomatic individuals, then we can at least conclude that if asymptomatic spread happens at all, it’s extremely rare.

“There were no positive tests amongst 1,174 close contacts of asymptomatic cases. ”

https://www.nature.com/articles/s41467-020-19802-w

Here’s another study that was also not able to find even one case of asymptomatic spread:

https://pubmed.ncbi.nlm.nih.gov/32513410/

This means that as far as the science goes, testing asymptomatic people is ludicrous since they don’t spread the virus, yet we are wasting millions of dollars on such tests.

For more on asymptomatic spread, see Proof of Asymptomatic Spread.

Lipid nanoparticle toxicity

The lipid nanoparticles (these particles in the mRNA vaccines deliver the mRNA into your cells) alone have killed mice in studies. “We found that ~80% of mice treated with 10 μg of LNP died in less than 24 hours.” The vaccine manufacturers have no interest in testing this further as they have no liability for any deaths.

Lipid Nanoparticles kill 80 percent of mice in PubMed Study

Spike protein

As of Jan 16, 2022, the CDC says the spike protein that is produced by the COVID vaccines is “harmless.” The scientific literature clearly shows that they are lying to the American public. What is their proof it is harmless? How do they respond to the papers cited below? If we can’t trust them on something this basic, how can we trust anything they tell us?

These papers in peer-reviewed medical literature show very clearly that the spike protein isn’t harmless. How does the CDC explain the discrepancy?

  1. Be aware of SARS-CoV-2 spike protein: There is more than meets the eye
  2. Toxicological insights of Spike fragments SARS-CoV-2 by exposure environment: A threat to aquatic health?
  3. SARS-CoV-2 Spike Protein Impairs Endothelial Function via Downregulation of ACE 2
  4. Pay no attention to the spike proteins behind the curtain
  5. Clearing up misinformation about the spike protein and COVID vaccines
  6. SARS-CoV-2 spike protein induces abnormal inflammatory blood clots neutralized by fibrin immunotherapy
  7. SARS–CoV–2 Spike Impairs DNA Damage Repair and Inhibits V(D)J Recombination In Vitro

Vaccine safety

If the CDC is correct and the vaccine is safe, how do they explain over 20,000 deaths reported in VAERS worldwide in a year? That is unprecedented. It is more deaths in one year than for all 70 vaccines combined over the past 30 years since VAERS was created.

The CDC is supposed to investigate each one of these deaths to determine whether or not it could be caused by the vaccine. Why are they not making these investigations public?!? This should be troubling to every American. Not a single death investigation has been made public. 0 for 20,000. That’s stunning. And the mainstream media, they aren’t asking any questions about this. How can there not be a single news story or op-ed about this?

As far as anyone knows, the CDC has not done an autopsy on any patient who died after vaccination. Not a single one. Why not?

How did Pfizer know that none of the deaths in the vaccine group were caused by the vaccine? Why can’t we see the in-depth analysis of those deaths? Why is it important that that analysis be kept private? We don’t know because they won’t tell us.

One of the world’s top pathologists, Dr. Peter Schirmacher, one of the world’s most respected pathologists, found that 30% to 40% of the deaths after vaccination were due to the vaccine. That is a bare minimum. It could be 100%. His results were independently confirmed by other German researchers who showed numbers as high as 93% of the deaths within 6 months after vaccination were caused by the vaccine itself (here and here).

Overall, the safety evidence is very troubling. All of these references show that the vaccines are unsafe.

  1. Vaccinated English adults under 60 are dying at twice the rate of unvaccinated people the same age. Since it is the healthy patients who opt for the vaccine, it can’t be explained by healthy-patient bias. This is a stunning observation, but taken alone, like most evidence, it is not definitive because of age confounding. A more in-depth analysis shows that at best, there is no benefit to vaccination at all, but it comes at “the expense of hundreds of thousands of serious adverse events in the UK alone (possibly over a million at this point), and several billion pounds from the public treasury.”
  2. It’s not just England that people under 60 are dying at double the rate. It’s happening in the US too. The CEO of a big insurance company in Indiana admitted to a 40% increase in deaths in ages 18-64 after the vaccines rolled out. That cannot happen by chance. Something is killing these people. If it isn’t the vaccine, then what is? It isn’t COVID. They’ve ruled that out. The insurance company didn’t track vaccination status. So let’s say it is the vaccinated dying at double the rate of the unvaccinated. Then if around half the people are vaccinated, that can explain the result they got; it is consistent with the stats in England.
  3. Prime age mortality SPIKED by 50% across multiple states during the year of the “life-saving” covid-19 vaccine. It’s not just Indiana. The dramatic increase in mortality among those under 50 is happening across all 50 states. These live saving vaccines are not preventing infection, nor are they saving lives. They are doing exactly the opposite.
  4. Using 12 independent methods (only one of them using VAERS), we can estimate that over 150,000 Americans have died from the vaccine in 2021
  5. The number of significant vaccine adverse events are thousands more than the CDC will admit. These are types of events, not rates. In other words the CDC says there are only a few serious events like myocarditis. But VAERS says there are thousands of different types of adverse events that are elevated by these vaccines.
  6. Myocarditis rates may be as common as 1 in 100 teenage boys, which is more than 100X higher than the CDC claims for the vaccine (1 in 13,000). One of us is lying. My rate can be derived from the VAERS data and also confirmed at a school near where I live. Here’s the chart from Jessica’s paper that was published and then improperly censored by the publisher of the journal after it appeared. Remember, the CDC says the myocarditis risk is only slightly elevated with the COVID vaccines. This looks like “slightly elevated” to you, right? It does to them.
  7. Pfizer’s own study shows 24% more people died in the vaccine group than the placebo group. The abstract of the paper didn’t mention this; it was focused on the lower infection rate for vaccinated patients.
  8. VAERS risk-benefit analysis shows that the vaccines cannot be justified for any age range: they kill more people than they save for all age rates.
  9. For young children, the risk benefit is off the charts. For ages 5 to 11, we’ll kill 117 kids for every child we might save
  10. Over 1,000 studies published in peer-reviewed medical journals say the vaccines are dangerous
  11. How do we explain the higher rate of death of athletes after the vaccines rolled out?
  12. There is evidence that the vaccines have increased the incidence of prion diseases.
  13. We don’t know what the long-term effects are. See for example, MIT Scientist: Covid Vaccines May Cause Diseases in ’10 to 15 years’ (Exclusive Video)
  14. Thailand experienced a 33% drop in the number of births in 2021 compared to 2020. This is interesting because you’d expect that lockdowns would have increased the number of births, not decreased them. England stopped tracking the same statistic in August 2021 for unknown reasons… maybe they thought it was too boring? The drop in births is not limited to Thailand. In the Philippines the same thing is happening: “a catastrophic drop in the number of babies born.”

Vaccine safety: seeing Black Swans are the new normal

After the vaccines rolled out, odd events started happening on a regular basis that never happened before. How do they explain “the new normal”?

  1. Over 10,000 “black swan” events post vaccine documented in a separate tweet. If the vaccine is so safe, how do all these “black swans” appear right after the vaccine?
  2. 60X increase in intracranial infections. These are deadly if not caught early.
  3. 13-year-olds dying from cardiac arrest
  4. Young adults dying in their sleep after getting vaccinated
  5. A 3-year-old dies from cardiac arrest just one day after getting the vaccine.
  6. 8-year-olds suffering from myocarditis. Unfortunately, Twitter removed Nurse Sarah’s account so you cannot see this tweet anymore. Here’s a screenshot of her pinned tweet before her account was removed. She’s been a nurse for 14 years and never saw this before in her career. This is the type of information Twitter doesn’t want you to know because it’s impossible for anyone to explain, so it has to be censored, which Twitter did:

VAERS shows cardiac arrest is elevated by 93X normal after taking the vaccines, and myocarditis is 131X more likely after taking the vaccine. So deaths from these causes happening shortly after vaccination are much more likely to have happened due to the vaccine than from natural causes.

Vaccine safety: brain hemorrhages

Let’s deep dive into one category of unusual events. How does the CDC explain all the reports of brain hemorrhages in young people with no head trauma? All of these cases have one thing in common: they happened shortly after the child took the jab. If these kids didn’t die from the vaccine, then what is the more likely cause?

  1. Baby Girl Dies From Brain Hemorrhage 5 Days After Pfizer Vaccine Shot
  2. Grieving mother in Trinidad grieves over her son who got jabbed and within hours he’s dead. “He was bleeding… he was bleeding in his brain.” Trinidad officials ignore her and encourage everyone to get vaccinated.
  3. The CDC did an in-depth investigation of the deaths of 12-17 year olds after the vaccine. Two of the 14 kids died from intracranial hemorrhages. This is extremely unusual since kids this age rarely die from intracranial hemorrhages. There are zero records in the entire 30 year history of VAERS of a kid in this age range dying of intracranial hemorrhage. Zero! Yet shortly after giving these vaccines to kids, we have two deaths from this cause. How do they explain that? Bad luck? Is it also bad luck that two kids died from pulmonary embolisms (PE) right after they started giving the vaccines to this age group? In the 30 year history of VAERS, only two kids died from PE. Also, statistics would have predicted only two natural deaths for the period analyzed for that age range. There were 14 deaths. This didn’t raise any alarm bells and they didn’t even mention it. They never addressed the cause of the excess deaths. They simply reported that kids died and changed the topic with no mention of the fact that the causes of death were highly unusual. Details of the shoddy analysis of the CDC is here. Please read it. When we kill our children and completely fail to investigate the cause of their deaths, we have a society that is morally bankrupt.
  4. The VAERS database clearly shows that intracranial hemorrhages are up by over 79X from baseline rates and up an incredible 954X baseline for pulmonary embolism. Yet the CDC doesn’t recognize either of these as risk factors for the vaccines. Multiple kids have died from these and the CDC can’t see a pattern. How do they explain the deaths?

Vaccine safety: Deaths have been determined to be caused by the vaccine yet the CDC claims to be still “studying” these cases

All of these deaths were determined by autopsy to be caused by the vaccine. The CDC obviously doesn’t agree, but won’t reveal the cause of death in any of these cases.

  1. Jacob Clynick, a 13-year old from Minnesota who died of cardiac arrest on June 20, 2021, just 3 days after his second Pfizer shot. The CDC never investigated the cause.
  2. The son of Ernest Ramirez was confirmed by Peter McCullough to have been caused by the vaccine. The CDC is silent. Ernest can’t get them to respond. Instead, FEMA is offering him money to change the cause of death from the vaccine to COVID. This is unethical, but that is how the government operates.
  3. Exclusive: Autopsy Confirms 26-Year-Old’s Death From Myocarditis Directly Caused by Pfizer COVID Vaccine. The CDC is silent once again.

There are many more of course. This is just a few of the most high profile cases in which it was clearly determined that the vaccine caused the death and the CDC looked the other way when asked to confirm the death. They always claim to be “studying” these cases, but never produce any evidence of this.

Vaccine safety: Excess deaths in VAERS

There were over 20,000 deaths reported in VAERS worldwide in the first year. Virtually all those were “excess deaths” which means they were in excess to the expected number of deaths that would normally be reported to the VAERS system due to background death rates.

If the vaccine didn’t cause all these deaths, then what intervention did?

Vaccine safety: other events indicating all is not right

None of these are dispositive on their own, but taken as a whole they are totally consistent with the vaccine is injuring people hypothesis and not consistent with the null hypothesis (the vaccine is not impacting people).

From readers:

  1. This week I was watching the European figure skating championships in Estonia. The ice skaters kept falling down, and the commentators remarked on this as very unusual.
  2. “I Am Upset Because We Don’t Talk Enough About the Side Effects” – Triple Vaccinated Swiss Olympic Athlete Sarah Atcho Develops Pericarditis
  3. Hazel O’Connor: Punk Icon In Induced Coma 1 Month After Receiving COVID-19 Booster Shot
  4. Florian Dagoury, the world’s top static freediver, complained that his abilities declined severely after getting the vax. Now we know why:
  5. I heard an unvaxxed commentator living near Washington DC say that he nearly gets in a car accident every time he goes on the freeway, because other drivers seem less focused. So I looked it up, and the US Department of Transportation’s National Highway Traffic Safety Administration reported “the largest six-month increase ever recorded in the Fatality Analysis Reporting System’s history. An estimated 20,160 people died in motor vehicle crashes in the first half of 2021, up 18.4% over 2020. That’s the largest number of projected fatalities in that time period since 2006.” (see here: https://www.nhtsa.gov/press-releases/usdot-releases-new-data-showing-road-fatalities-spiked-first-half-2021).
  6. I would normally see 4 or 5 crashes a year IF that.

    Last week I saw 6 separate crashed car. One happened 5 minutes in front of me and I drove past as the cops arrived. 2 of the crashes were on a straight road where the driver just went off the road and into the trees for no reason.

    So there is a massive spike in car crashes.

    Usually a crash would involve 2 or more cars. It is weird seeing multiple separate crashes, especially on a straight road in fine weather – no ice or rain.

  7. IVF clinics started having serious problems after the vaccines rolled out
  8. An alarming 360X increase in adenopathy is happening after the vaccine roll out

Vaccine efficacy

These studies all show that the more you vaccinate, the worse the outcomes. Overall, the nations who vaccinate the most have the highest infection and death rates. That’s the opposite of what was promised. And the funny thing is that nobody can show an error in any of these studies. Do you think they are all wrong? Can you find the error in all of them?

  1. UK Government Data proves the Covid-19 Vaccines DOUBLE your chances of catching Covid-19. No age confounding on this one. This will be hard for anyone to explain.
  2. Scotland data clearly shows the vaccines are making things worse.
  3. New big data study of 145 countries show COVID vaccines makes things worse (cases and deaths)
  4. The Harvard study
  5. The German study
  6. The Denmark study (shows that against Omicron, we need to vaccinate people every 60 days or so and after that the vaccine efficacy goes negative). A Reuters fact check cannot change that fact.
  7. German government data (this is from The Expose and was based on the German government data at the time it was written. The German government then changed the data after the article revealed the problem which made the problem go away.
  8. 80% of the COVID deaths in the UK are vaccinated
  9. Lancet: 89% Of New UK COVID Cases Among Fully Vaxxed
  10. Official UK Government data suggests Fully Vaccinated Brits will develop Acquired Immunodeficiency Syndrome by the end of February 2022
  11. The Lyons-Weiler study
  12. Florida: Highest Rates of Infection Occurring in Counties with Highest Vaccination Rates
  13. Vaccine Failure – Across the Board. Negative efficacy in UK. The vaccines are not only failing to prevent infection, but they are making you more vulnerable to infection.

Pfizer’s own study showed that for 220M fully vaccinated people, we save at most 10,000 lives. Thus, we kill at least 15 people (all-cause mortality) for every person we save, which makes the vaccines nonsensical. See the previous section.

Here’s the kicker. The Denmark study was confirmed in an Israeli trial which concluded that a 4th dose is not enough. So basically they think that if you double vax and then triple boost someone that will do it. Five doses. That is unbelievable. There is no precedent for that. The Denmark study basically showed that the more you vaccinate, the easier it is for the virus to infect you. It’s crystal clear. They can give you infinite doses and it will not matter. Things will get worse and worse on each dose and the officials will still think that the solution is more doses. They’ll never figure out that early treatment is the better path. Insanity is doing the same thing over and over again and expecting a different result. This is actually worse than that: they are doing the same thing over and over again, each time getting a reduced result, and hoping it will just magically go the other way. Why are they doing these mass experiments on people? How is that ethical?

Vaccine risk-benefit analysis

Have you ever noticed that the Emperor has no Clothes?

We are told we should vaccinate to “protect others,” yet nobody has presented a risk-benefit analysis that justifies this.

Have you ever wondered “why is there no risk-benefit analysis?” If you have, you are probably a critical thinker and US CDC health guidelines requires you to immediately watch this helpful instructional video produced by Dr. Death that explains how people like you are a danger to society and what you can do about it.

On the other hand, we do have risk benefit analyses showing it is totally nonsensical for you to get the shot:

  1. VAERS risk benefit analysis shows vaccines make no sense for any age group
  2. Risk-benefit analysis shows we kill 117 kids for every child we might save from a COVID death

Ask yourself, would you voluntarily take a shot that has a 1% chance of killing or permanently disabling you in order to potentially save the life of someone else (likely an old person)?

This has never been about your safety. It is a single-minded agenda to vaccinate all living people. Period.

In California, if you are a healthcare worker who has been vaccinated and you have COVID you are allowed to work. If you are unvaccinated and don’t have COVID, you are fired (causing staffing shortages). This is not about your health. This is about forcing compliance with orders from the government, not about patient safety.

Similarly, the masking/social distancing guidance is going to make you less safe since they make you believe that they work and keep you safe when they don’t. They never tell you about the P100 masks.

They never tell you about the adverse events in VAERS after the vaccine.

They bury vax injuries like Maddie de Garay under the rug and make sure nobody sees it.

After his booster, Governor Newsom tweeted he had developed Guillain-Barre and then quickly deleted it. Today, he acts like it never happened. He’s not disclosing the injury so you’ll get injured just like he did.

Finally, why the rush to vaccinate kids? Even a top WHO official admits this is silly:

Twitter avatar for @IanLyne3Ian Lyne @IanLyne3

Top WHO scientist Dr. @doctorsoumya says there’s no evidence healthy children and adolescents need #COVID19 boosters. #TogetherDeclaration

This is not about your safety. It never has been.

Mask effectiveness

The CDC knows damn well that randomized trials are much more reliable than non-randomized trials. So when the randomized trials for cloth and surgical masks showed that they didn’t work, the CDC simply ignored those trials and focused on confounded studies that supported their belief system. This is deceptive and unethical and not a single member of the mainstream medical community has called them out on this.

  1. Cloth and surgical masks appear to be completely useless against COVID according to all the randomized trials done with COVID (Denmark and Bangladesh). None of the trials found a statistically significant effect.

    Note that the Denmark study was re-written so the journal would publish it. This is called making the science fit the narrative and is unethical. The Bangladesh study concluded masks work, but Yale and Stanford professors were caught with their pants down when UC Berkeley Professor Ben Recht showed their conclusions were wrong and that masks did nothing. We got the data ourselves and did an independent analysis and found that Recht was spot on. When I pointed out the error to the author of the article in Nature in an email on December 11, she ignored me. Science doesn’t matter. If your study supports the narrative it gets published and covered by the mainstream press. That’s the way it works today.

    At a minimum, since the high quality science clearly shows that cloth and surgical masks were useless for COVID, why weren’t people alerted to the fact that these interventions were false “security blankets” that never provided any actual protection?

  2. N95 and FFP2 masks, make absolutely no difference in real world studies (the graphs are identical to surgical masks). Indeed, extensive scientific literature establishes that wearing surgical masks and respirators (e.g., “N95”) does not reduce the risk of contracting a verified illness. Additionally, N95 masks are very hard to wear for long periods.
  3. The only mask that has the potential to significantly reduce your risk of COVID infection are P100 respirators. They are far superior than any of the options previously recommended by the CDC. They are roughly 150X more effective than a perfectly fitted N95 mask. This was well known, yet it wasn’t until nearly two years into the pandemic that the CDC finally mentioned P100 respirators in their masking guidance starting on September 10, 2021. Why didn’t the CDC wait so long before notifying the public to this more effective option earlier?

Why haven’t we seen a single CDC official wearing a mask that actually provides adequate protection against COVID? Instead we see them wearing protection that quality scientific studies have proven makes absolutely no difference. They have jeopardized lives by promoting interventions that are nonsensical and not supported by randomized trials. What’s worse is they led people to believe the interventions worked. You can’t have it both ways. You cannot ignore 32 randomized trials that show that ivermectin works and still not recommended while at the same time you have zero randomized trials for cloth and surgical masks that show they work and mandate the wearing of such masks. How do you explain that?

CDC chief said change on mask guidance not due to public pressure - POLITICO
This is Rochelle Walensky, head of the CDC, wearing a mask that is proven in multiple randomized trials to have no effect whatsoever to stop COVID. Why would any sane person do that?
  1. 47 studies show conventional masks don’t work against viruses

Finally, school boards are the worst offenders. White House Press Secretary Jen Psaki applauded the county where her kids go to school for imposing a mask mandate. Guess how many kids at her school are wearing P100 respirators that actually reduce the chance of getting COVID? That’s right: zero. It is so comical. You can’t make this stuff up.

Virginia Governor Glenn Youngkin got it right. He basically forbids schools to mandate masks. If kids want to wear masks that basically do nothing other than put their health at risk, they are free to do so.

My articles on masks with detailed references:

  1. Do Masks work?
  2. Masks don’t work
  3. P100 respirators

Mask safety

If we exclude mask efficacy studies w.r.t. filtering out viruses (covered in the previous section), I have yet to find a single study showing that wearing masks improves health outcomes. This should be much of a surprise. If this were the case, we’d have all been walking around with masks decades ago.

  1. 32 studies showing that wearing masks are dangerous to health
  2. More downsides of mask wearing (see the section “There are downsides of mask wearing”)
  3. We still don’t know the cause of the huge uptick in intracranial infections but the doctors I talked to say it is a perfect storm of cloth/surgical masks, the vaccine, and testing swabs.

Social distancing (6 feet) does not make any difference

It doesn’t work. The virions stay in the air for days after someone breathes them out. The bigger the room, the lower the concentration. Masks have no hope of filtering them out and reducing your risk. Respirators can work, but only if fitted and used properly.

It’s all about the 4 D’s: dimension, duration, density, distance.

You want to maximize dimension and distance and minimize duration and density. So there is no magical 6 foot threshold where if you are 6 feet away you are safe.

Here’s a simple example: suppose the threshold for infection is 100 virions. You might be exposed to 1M virions over the course of time in a room. So any intervention that reduces your exposure by 50% will not make any difference whatsoever since 500,000 » 100. You need something that reduces your risk by more than a factor of 1,000 in our example.

For more information, see P100 respirators and look at the section entitled, “What you need to know about the virus and PPE”.

Mandates (vaccine and masks)

  1. It makes no sense to mandate a vaccine that kills more people than it saves.
  2. If the vaccine works, you don’t need the mandate. If the vaccines don’t work, you don’t need a mandate.
  3. If the masks work, you don’t need a mandate. If masks don’t work, you don’t need a mandate.
  4. Mandating masks is nonsensical because all the randomized trials show they do nothing and there are 32 studies showing they are harmful.

Here are 7 arguments prepared by a large group of German physicians as to why the mandates are nonsensical.

This article disclosing data from the UK government shows hardly anyone under 24 dies from COVID. Mandates are therefore insane for those under 24. How can we mandate a vaccine (especially one that is unsafe as this one) when there isn’t a problem??

Lockdowns

  1. There is no evidence that lockdowns have been effective that I’m aware of. Read this.

Early treatment protocols

If our pandemic response was just to let people know about early treatment protocols and encourage people who are symptomatic to get treatment, we would have minimized hospitalization and death and not needed to engage in any other intervention (vaccines, masks, shutdowns, etc).

Over 7,000 people have been treated with the Fareed-Tyson early treatment protocol. If the treatment is started immediately after the first symptoms, nobody was hospitalized or died. The protocol was first available in March 2020. They tried to interest the NIH and mainstream media in the protocol, but the NIH ignored all their requests. Details in their book which will be available January 24, 2022.

Fluvoxamine alone can reduce your risk of death from COVID by 12X. It should be part of every treatment protocol. However, because it is a generic drug, the FDA won’t approve it even though it works better (and is safer) than the two drugs they did approve.

For a more complete list of early treatment protocols, see How to treat COVID, long-haul, and COVID vaccine side-effects.

Censorship

The President of the United States has a list of people he wants censored. This is a first for America. Government-sponsored censorship. Wow.

Since censorship worked and nobody in Congress voiced opposition to Biden’s list, I wouldn’t be surprised if the next step is to put people such as myself in jail for spreading “misinformation that in the government’s view could harm people.”

On January 13, Biden again called for companies to censor misinformation. Who is the judge of what is misinformation? The social media companies of course!

What happens when truth is not suppressed? The most popular podcasts in history. Both the Robert Malone and Peter McCullough interviews have over 50 million and 40 million views, respectively, which are a new record. This is 50X more than CNN gets. It certainly appears that America is interested in hearing information from a trusted news source, so why is the government so intent on censoring this information? See this video starting at 9:00 (trust me on this).

Robert Malone and I were permanently banned from Twitter and LinkedIn, for example. However, for some odd reason which I cannot explain, my Twitter account was resurrected but Malone’s was not. Perhaps they want to let me Tweet so they can put me in jail later for spreading misinformation.

Fraud / Malfeasance / Corruption

Here are just a few examples of fraud and/or malfeasance:

  1. The drug companies have FULL liability protection. They cannot be sued if you die or are disabled. Why is the liability protection necessary if the vaccines are “safe and effective” as the CDC claims? I’m still baffled by this.
  2. There is no stopping condition for the vaccine experiment. That is unheard of. We could kill 1M kids and they wouldn’t stop it. The mainstream press never asks this question (and they never will). I’ve asked members of Congress, but they refuse to answer.
  3. There is no transparency of the data. Even the BMJ is up in arms about this with three editors saying this is wrong.
  4. The FDA originally asked a court to allow them to release the Pfizer documents over 75 years so we’ll all be dead before we can see what they are injecting us with. How is this in the public interest?
  5. The damage from the vaccines is irreversible. Once your child is dead, you can’t bring them back. Once you damage your heart or brain, it cannot be repaired. The vaccines were never properly tested by the FDA in animals. We don’t even know the amount, distribution, and duration of the spike protein in primates. It was never measured. Basic measures of clotting and heart damage (d-dimer and troponin) post-vaccine still are not known, probably because they know it is really bad and don’t want anyone to know. It is inexcusable that they have not required the drug companies to measure and report this information.
  6. I have tried incessantly to get a recorded video call with anyone from the FDA, CDC, and NIH to explain the evidence in this document. They claim I’m wrong and refuse to meet with me or any member of my team. Even more troubling is that when we offered to share all the adverse event analysis we did in VAERS, they wouldn’t even respond to our offer. They have no interest at all in seeing safety data that goes against the narrative of safe and effective.
  7. The CDC told people that cloth and surgical masks work to protect them from COVID. They do no such thing. All of the randomized trials for these masks and COVID showed they had no statistically significant effect. That’s why the CDC never references these studies because they don’t support their narrative. The public is misled into believing they are protected when they aren’t. They could have recommended P100 masks at the outset, but they didn’t do that. They left people without protection, but thinking they had protection. That’s really bad.
  8. The NIH, CDC, and FDA all unethically suppressed early treatment. They minimally funded these studies. When fluvoxamine was shown to work, they refused to issue and EUA and the NIH rated the drug neutral. They did similar things for vitamin D, ivermectin, HCQ, etc. All early treatments using inexpensive repurposed drugs that worked were suppressed. What are the chances that none of these drugs listed on that page work? It’s virtually zero.
  9. The US government deliberately withheld monoclonal antibodies that some physicians believe could have saved hundreds of thousands of lives had they been aggressively made available and promoted.
  10. Maddie de Garay was a participant in the Pfizer 12-15 year old clinical trial. She’s paralyzed likely for life and her paralysis was reported as “abdominal pain” by Pfizer. Had it been correctly reported, the drug wouldn’t have been approved. FDA Commissioner Janet Woodcock promised to investigate why Maddie’s paralysis wasn’t reported correctly in the Pfizer clinical trial, but Maddie’s parents were never contacted by anyone from any agency looking to investigate the matter.
  11. When you are vaccine injured, the NIH has no clue whatsoever for how to treat you to restore you to health. They know this. But they are not disclosing this to the public. The public still thinks the vaccines are perfectly safe.
  12. When John Su, the CDC’s VAERS expert, reports numbers from VAERS, he never calculates the underreporting factor (URF). He deliberately misleads everyone by failing to note that the true event rates are close to 100X higher than he reports. Even worse is when the FDA is contacted by a former NY Times reporter who asks for the URF and the document showing the URF calculation, the reporter is stonewalled and never given a response. This is critical since the URF is required in order to do even the most basic risk-benefit analysis. It is astonishing that neither the VRBPAC nor ACIP committee members never asked for this. They are corrupt as well. There is no excuse for this. The mainstream press isn’t asking any questions on this as usual.
  13. Pfizer claimed that all the deaths in the vaccine arm were not caused by the vaccine. Seriously? How is that possible? Did they do autopsies? I believe they lied. I’d like to see how they can have a 4X higher rate of death from cardiac arrest in the vaccine group and show conclusively that it wasn’t caused by the vaccine. Did they do a thorough autopsy? This is extremely important and was simply glossed over. People died and as far as we know, the FDA never asked any questions about how they died and how the vaccine could have been ruled out. We are simply told, “Trust us, our employees determined it wasn’t vaccine related.” This is outrageous. Has anyone else called for this other than members of our team of scientists? I think it is pretty damn important that this is not buried. By not producing this analysis and making it public, it erodes public trust in the entire system because these are supposed to be the most scrutinized trials in US history. Not showing the analysis of each death in the treatment group is unacceptable. We want to see how the autopsy results excluded the vaccine as being causal. Where is it? How come nobody in the mainstream medical community is asking about this?
  14. The FDA never took a serious look at the Pfizer trial. How can there be 5 times as many dropouts in the treatment group vs. placebo? That is statistically impossible. 311 vs. 60. Those numbers should have been the same if the trial wasn’t gamed. The Pfizer whistleblower admitted that the trial wasn’t blinded; that’s how they can accomplish this:
  15. The population of the Pfizer trial was supposed to be representative of the US population, but these people were much healthier… they died at 1/5 the rate they were expected to die. And when they did die, Pfizer didn’t really investigate the cause (as noted earlier).
  16. The CDC says there are no safety signals from VAERS for the mRNA COVID vaccines other than myocarditis. The VAERS database is flashing RED for thousands of adverse events and the FDA and CDC are ignoring all of them including all of the reasons that the kids died in their 12-17 VAERS study which included cardiac arrest, intracranial hemorrhage, and pulmonary embolism.
  17. The CDC claims nobody has died from the mRNA vaccines. They are lying. They know directly of many cases that have been brought to their attention, but they ignore them, saying they are “investigating” them. Dr. Peter Schirmacher, one of the world’s most respected pathologists, found that 30% to 40% of the deaths after vaccination were due to the vaccine. His results were independently confirmed by other German researchers who showed numbers as high as 93% (here and here).
  18. Brook Jackson, who worked as a contractor on the Pfizer trial, was appalled by what she observed including the unblinding of personnel on what is supposed to be a double-blind trial. She contacted the FDA in confidence and was surprised that the very next day she was fired. How is that possible if the FDA didn’t leak info to Pfizer?
  19. We still do not know the contents of each vaccine. It’s illegal for anyone to have it analyzed. If there is nothing to hide, why can’t we analyze what is in the vials?

Intimidation tactics

  1. COVID-19: Stigmatising the Unvaccinated is Not Justified (The Lancet)

100 things to fix for the next pandemic

I made a list of 100 things that should be fixed before the next pandemic. I’ll be publishing it soon on my Substack and then will link to it here.

If they can fix a couple of things on the list before the next time, I’ll be impressed.

A rational pandemic response

None of the interventions that have been recommended by the CDC to date (January 16, 2022) have been necessary. None. Zero. We could have completely ended the pandemic in March 2020 had the CDC adopted one of the existing early treatment protocols, such as the Fareed-Tyson protocol.

For more information, see How I would handle the pandemic.

Data supporting their narrative falls short… way short

One of the key papers they use to support the official false narrative is the Barda paper which appeared in NEJM documenting a study done in Israel. It showed that the risks from the vaccine were minor compared to the risks from the virus. This is a fundamental to justifying the vaccines and is often cited by external committee members.

There is just one tiny problem with that paper: it’s deeply flawed. It doesn’t match reality at all.

There are several obvious problems with their analysis:

  1. It’s an unfair comparison since everyone has to take the vaccine, but not everyone will get COVID. The paper compares absolute rates (i.e., assumes everyone gets COVID).
  2. The analysis of adverse events is nonsensical. In Figure 3, it shows that the vaccine strongly reduces the risk of pulmonary embolism and intracranial hemorrhage, for example. That’s impossible. There is no plausible mechanism of action for that; the mechanism of action would predict just the opposite.
  3. The VAERS data is also quite clear that those events are strongly increased by the vaccine, not reduced. Pulmonary embolism, for example, is elevated by 954X over normal for example. The paper claims it is less likely to happen. They can’t both be right.
  4. The paper claims the rate of myocarditis is lower for the vaccine than COVID yet you cannot find a cardiologist in the country who has observed that; it’s just the opposite. They can’t both be right.

Another paper they use to show how safe the vaccines is a CDC analysis that after you get vaccinated, your all-cause mortality drops by 72% if you are age 18-44. This is pure fiction as it is contradicted by real-life data which was very strongly in the opposite direction. I wrote an analysis of the CDC paper showing how absurd this paper was.

They also claim this is a pandemic of the unvaccinated, but private internal hospital correspondence indicates otherwise, as do surveys of healthcare providers. If this is a pandemic of the unvaccinated, then how is it possible that 90% of the ICU patients in the UK are vaccinated? Nobody wants to explain that. At UCSD, 90% of their ICU patients are vaccinated as well. Odd, isn’t it?

In fact, the authorities in the UK are sending in teams of people to people homes to vaccinate them. It’s a great plan. If everyone is vaccinated, then there is no control group left and nobody will know that the vaccinated are worse off than the unvaccinated since there will be no unvaccinated left to compare with. Get it?

In the US, they are also finally admitting that far more people are hospitalized with COVID, rather than from CVOID… like 75% are “with” COVID.

In summary, their narrative is falling apart as shown in this special episode of “We lie to you news.”

The narrative keeps changing

Have you noticed that the narrative keeps changing? This doesn’t happen for other vaccines. This vaccine is very unique; nurses have never seen anything like this in their careers.

What happens next

Some doctors in the UK are starting to advise patients that the vaccines will be “completely stopped” (start listening at 50 seconds into it). Note that Twitter removed the original post as a violation of their terms of service (I think because it shows the vaccines are unsafe which you aren’t allowed to do), so I updated the link to Telegram where you can hear the entire call.

A quote from Dr Aseem Malhotra, Cardiologist, UK, tweeted: @DrAseemMalhotra · Jan 17, 2022

“My biggest fear now is that it’s going to get violent. When the truth comes out we must do all we can to stop that & show compassion to those who got it very VERY wrong. This is not individual failure but that of a corrupted system that needs to be dismantled & rebuilt TOGETHER!”

Do you have a good doctor?

Here’s a simple test. If you have a good doctor, they’ll tell you:

  1. the vaccines are unsafe
  2. cloth and surgical masks are useless to stop infection
  3. ivermectin and fluvoxamine work

Take action

You can make a difference.

Ask your doctor, school board, city council, and your members of Congress to address the issues raised in this document and to explain why this evidence is wrong.

Please share with us all what they say in the comments below.

Source:  stevekirsch.substack.com/p/incriminating-evidence

2 thoughts on “Incriminating evidence

  1. Steve,

    you need to finally grasp, this is a MASSIVE GENOCIDAL plan, performed already for MANY decades. The LAST covid step in human history started with REDEFINITIONS OF the word ‘vaccine’, which synthetic, modified mRNA is NOT. It is a GENETIC MATERIAL WHICH REPROGRAMS ALL THE ACCESSIBLE CELLS IN THE HUMAN BODY AND IT MAKES SOMETHING DIFFERENT WITH THEIR NORMAL FUNCTION. While sticking to the FDA redefinition you SUPPORT THEIR GOAL of a total MISINFORMATION of uneducated people!!! Get this, despite of all your great outcry, you are PART OF THE DECEPTION!!!! The no 1 in this fight is to make everyone CLEAR, that covid goal is to GENETICALLY MODIFY with a handful of SYNTHETIC GENES the entire WORLD POPULATION, which ends with PATENTABLE entities! HUMANS were NEVER SYNTHETIC, until now, with so far 10 BILLIONS of covid injections applied, according to nature.com. That’s called ANNIHILATION of HUMANITY via genetic modifications by the SATANIC eugenists, who can’t stand to see God’s creation walking on this planet!

  2. All, Please listen to a talk on brighteon, titled:”Military Lawyer says Genetic Changes from VACCINE are Creating NEW HUMAN ‘SPECIES’ under the LAW”. Todd Callender is the only lawyer who is seeing the entire crime with the right eyes and mind. My salute to him! The absolute arrogance of the, I’d say, satanic clan, whose no 1 enemy is the original Creator, is the new law according to which in the ‘name of science’ one has to undergo this modification procedure in order to avoid a flu. Going into depths of the Spike official genome, stored at the NIH library with the code NC_045512.2 (that’s the entire SARS-CoV-2 having the spike under YP_009724390.1), one can assume, that according to the available patents, that sequence is exactly the part of all the injections with one or more mutations, according to the original 2020 Pfizer NEJM paper.

    Bioinformatics analysis of the Spike genome points indeed to countless pieces of other proteins, which can’t be ‘just a coincidence’, even if it is an identical section of a di-,tri- or any oligopeptide, which represent s.c. epitopes shared with the Spike. An example of this is the dipeptide ‘PF’=Proline-Phenylalanine which is embedded 9 TIMES in Spike sequence, and whose function is to INHIBIT ACE2 receptor. Let’s take an example of gp160 HIV, the envelope surface glycoprotein with the code NP_057856.1.

    91% of its sequence is covered by Spike, with 27% of identities like (format issue in the display caused by pasting from BLAST result):
    Query 1205 KYEQYIKWPWYIWLGFIAGLIAIVMVT 1231____ (COVID spike protein)
    _______KY+ _ +W W W + G++ I T _____________________IDENTITIES
    Sbjct 6 KYQHLWRWGWR-WGTMLLGMLMICSAT 31_______ HIV gp160=gp120+gp41
    or
    Query KCVNFNFNG 545 ____Spike
    _____KC__N_FNG _____Identities
    Sbjct_KCNNKTFNG 235_____HIV gp160
    or
    Query 495 GVSPTK 500____Spike
    _______GV+PTK____Identities
    Sbjct 381 GVAPTK 386_____HIV gp160
    or the well known furin site compared by hand:
    PRRARSVASQ __Covid spike
    PRR_R _______ _Identities
    PRRIRRQGLE ___HIV gp160 glycoprotein

    In my opinion this is relevant, that the infectivity in covid19, dependent on the newly inserted furin site
    and the rich W i.e. tryptophan section, overlaps in both pathogens. Here another example of epitope homologies between Spike and anthrax toxin:
    Query 46 SVLHSTQDLF 55
    _________SVLH____+++
    Sbjct 201 SVLHHWNEIY 210

    Few examples of homologies between human prothrombin and covid SPike:
    Query 262 AAAYYVGYLQPRTF Spike
    _______A +__Y___+ PRTF Identities
    Sbjct 316 ATSEYQTFFNPRTF Human Prothrombin
    Query 1179 IQKEIDRLNE 1188 Spike
    ________IQK__ID+_ E______Identities
    Sbjct 613 IQKVIDQFGE 622__Human Prothrombin
    Query 233 INITRFQTLLALHRS 247
    _______+NITR_____L_RS
    Sbjct 120 VNITRSGIECQLWRS 134

    Or an example of transmissible gastroenteritis swine flu virus and its envelope protein which is to ~32% IDENTICAL with the covid SPike:
    Query 681 PRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTM 740 Spike
    + I T S+G ++ N + IPTNFTISV E + V T S+DC+
    Sbjct 813 -GALVSINVTHSVGDVQPISTGN–VTIPTNFTISVQVEYIQVYTTPVSIDCSR 863 swine flu virus env
    Query 788 —–IYKTPPIKDFGGF—NFSQILP-DPSKPSKRSFIEDLLFNKVTLADAGFIKQ-Y 837 Spike
    ______________ IYK P + GG ILP D S RS IEDLLF+KV + G + + Y
    Sbjct 924 ETLDPIYKDWP–NIGGSWLEGLKYILPSDTSNRKYRSAIEDLLFSKVVTSGLGTVDEDY 981 Swine flu virus envelope
    Query 1171 GINASVVNIQKEIDRLN———–EVA—KNLNESLIDLQELGKYEQYIKWPWYIWL 1218 Spike
    NA+ +N+ EID L E+A N+N +L++L+ L + E Y+KWPWY+WL
    Sbjct 1335 -FNATYLNLTVEIDDLQFRSEKLHNTTVELAILIDNINNTLVNLEWLNRIETYVKWPWYVWL 1395 Swine flu

Leave a Reply

Your email address will not be published.